compare

Comparison List

Electra1

Electra1 is a basic (constitutively fluorescent) blue fluorescent protein published in 2022, derived from Entacmaea quadricolor.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: 5X9A8

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
402 454          

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
950.0 4.25 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)
2124.0 0.91 (mW/mm2) LED Widefield HEK293T 21.0 Papadaki et al. (2022)
185.0 3.72 (mW/mm2) LED Widefield Primary hippocampal mouse neurons 21.0 Papadaki et al. (2022)

Electra1 Sequence

Electra1 was derived from mRuby3 with the following mutations: K6E/M63L/Y64F/R67K/E114G/K138E/N143F/D151N/G167D/C172A/F174I/N186D/H197Y/I202V/Q213L
amino acid numbers relative to eqFP611. show relative to mRuby3

MVSKGEELIEENMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFLFGSKTFIKYPADIPDFFKQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGGLVYNVKVRGVNFPSNGPVMQKKTEGWEPFTEMMYPANGGLRGYTDIALKVDGDGHLHANIVTTYRSKKTVGDIKMPGVHAVDYRLERVEESDNETYVVLREVAVAKYSNLGGGMDELYK
GenBank: OL631606

Excerpts

Quantification of intracellular brightness revealed that Electra1 and Electra2 were 2.3- and 2.1-fold brighter than mTagBFP2

Papadaki et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change