compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Electra1

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Jun 25, 2022 15:58:35. Or view the full change history

Electra1 is a basic (constitutively fluorescent) blue fluorescent protein published in 2022, derived from Entacmaea quadricolor.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Entacmaea quadricolor	26.4 kDa	-

FPbase ID: 5X9A8

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
402	454	69,750	0.74	51.62			3.4

Edit States/Attributes

Photostability

t_1/2 (s)	Power	Light	Mode	In Cell	˚C	Reference
950.0	4.25 (mW/mm2)	LED	Widefield	HEK293T	21.0	Papadaki et al. (2022)
2124.0	0.91 (mW/mm2)	LED	Widefield	HEK293T	21.0	Papadaki et al. (2022)
185.0	3.72 (mW/mm2)	LED	Widefield	Primary hippocampal mouse neurons	21.0	Papadaki et al. (2022)

A caution on interpretation of photostability measurements

Add photostability info

Electra1 Sequence

BLAST

Electra1 was derived from mRuby3 with the following mutations: K10E/M67L/Y68F/R71K/E118G/K142E/N147F/D155N/G171D/C176A/F178I/N190D/H201Y/I206V/Q217LK6E/M63L/Y64F/R67K/E114G/K138E/N143F/D151N/G167D/C172A/F174I/N186D/H197Y/I202V/Q213L
amino acid numbers relative to mRuby3eqFP611. show relative to eqFP611 show relative to mRuby3

MVSKGEELIEENMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFLFGSKTFIKYPADIPDFFKQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGGLVYNVKVRGVNFPSNGPVMQKKTEGWEPFTEMMYPANGGLRGYTDIALKVDGDGHLHANIVTTYRSKKTVGDIKMPGVHAVDYRLERVEESDNETYVVLREVAVAKYSNLGGGMDELYK

GenBank: OL631606

Excerpts

Quantification of intracellular brightness revealed that Electra1 and Electra2 were 2.3- and 2.1-fold brighter than mTagBFP2

Papadaki et al. (2022)