compare

Comparison List

Dendra

Dendra is a photoconvertible red fluorescent protein published in 2006, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 25.6 kDa -

FPbase ID: GJDTN

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 488 505 21,000 0.7 14.7 6.6    
Red 556 575 20,000 0.72 14.4 6.9    

Transitions

From To Switch λ
Green Red 405

Photostability

No photostability measurements available ... add one!

Dendra Sequence

Dendra was derived from dendFP with the following mutations: L40A/L61V/Y95F/N121K/M123T/Y188A/S199G/G213A

MNLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQAW

Excerpts

To make dendGFP suitable for protein labeling we generated a monomeric variant, named Dendra (from Dendronephthya sp., red activatable), using mutagenesis strategy suggested for monomerization of green fluorescent protein Azami-Green. In contrast to a recently developed monomeric version of EosFP, called mEosFP, Dendra completely matures at 37 °C in both bacterial and mammalian cells. Bacterial colonies expressing Dendra can be irreversibly converted from green to red fluorescent states by irradiation with a 405-nm light using a fluorescent stereomicroscope. For purified Dendra, we achieved a 350-fold increase of red fluorescence and a fivefold decrease of green fluorescence resulting in a 1,400-fold contrast between the ground and activated states.

Gurskaya et al. (2006)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change