compare

Comparison List

Dendra

Dendra is a photoconvertible red fluorescent protein published in 2006, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 25.6 kDa -

FPbase ID: GJDTN

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 556 575 20,000 0.72 14.4 6.9    
Green 488 505 21,000 0.7 14.7 6.6    

Transitions

From To Switch λ
Green Red 405

Photostability

No photostability measurements available ... add one!

Dendra Sequence

Dendra was derived from dendFP with the following mutations: L40A/L61V/Y95F/N121K/M123T/Y188A/S199G/G213A

MNLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQAW

Excerpts

To make dendGFP suitable for protein labeling we generated a monomeric variant, named Dendra (from Dendronephthya sp., red activatable), using mutagenesis strategy suggested for monomerization of green fluorescent protein Azami-Green. In contrast to a recently developed monomeric version of EosFP, called mEosFP, Dendra completely matures at 37 °C in both bacterial and mammalian cells. Bacterial colonies expressing Dendra can be irreversibly converted from green to red fluorescent states by irradiation with a 405-nm light using a fluorescent stereomicroscope. For purified Dendra, we achieved a 350-fold increase of red fluorescence and a fivefold decrease of green fluorescence resulting in a 1,400-fold contrast between the ground and activated states.

Gurskaya et al. (2006)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change