compare

Comparison List

Clover

Clover is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2012, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with high acid sensitivity.
+
Clover Spectrum Fluorescent protein Clover excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: 4Z641

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
505 515 111,000 0.76 84.36 6.2 30.0 3.2

Clover OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
72.9 ± 5.5 (10000 cells) - HeLa Shaner et al. (2013)
72.9 ± 5.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
50.0   Shaner et al. (2013)

Clover Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTFGYGVACFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: AFR60231
IPG: 30275454

Structure

Deposited: ,
Chromophore:

Excerpts

With a completely deprotonated chromophore at neutral pH (pKa = 6.1), Clover should be incapable of photoconversion despite the presence of His203, which enhances photoconversion in PA-GFP. Indeed, we observed no photoactivation of Clover in illumination conditions that produced more than threefold photoactivation of PA-GFP.

Lam et al. (2012)

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change