compare

Comparison List

PA-GFP

similar: mPA-GFP

PA-GFP is a photoactivatable green fluorescent protein published in 2002, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.0 kDa -

FPbase ID: 7QYHY

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 504 517 17,400 0.79 13.75      
Off              
Edit States/Attributes

Transitions

From To Switch λ
Off On 400
Edit state transitions

Photostability

No photostability measurements available ... add one!

PA-GFP Sequence

BLAST

PA-GFP was derived from avGFP with the following mutations: M1_S2insV/V163A/T203H/H231L

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for PA-GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Photoactivatable GFP for Selective Photolabeling of Proteins and Cells

Patterson Gh

(2002). Science, 297(5588) , 1873-1877. doi: 10.1126/science.1074952. Article   Pubmed

Additional References

  1. Single-molecule evaluation of fluorescent protein photoactivation efficiency using an in vivo nanotemplate

    Durisic N, Laparra-Cuervo L, Sandoval-Álvarez , Borbely Js, Lakadamyali M

    (2014). Nature Methods, 11(2) , 156-162. doi: 10.1038/nmeth.2784. Article   Pubmed

  2. Structure and Mechanism of the Photoactivatable Green Fluorescent Protein

    Henderson Jn, Gepshtein R, Heenan Jr, Kallio K, Huppert D, Remington Sj

    (2009). Journal of the American Chemical Society, 131(12) , 4176-4177. doi: 10.1021/ja808851n. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change