compare

Comparison List

Comparing:

mScarlet, mScarlet-I, mScarlet-H

You can share this comparison at: www.fpbase.org/compare/mscarlet,mscarlet-i,mscarlet-h

Attribute Comparison

Name λex λem StokesλΔ EC QY Brightness pKa Aggregation Maturation Lifetimeτ kDa
mScarlet 569 594 25 100,000 0.7 70.0 5.3 m 174.0 3.9 26.35
mScarlet-I 569 593 24 104,000 0.54 56.16 5.4 m 36.0 3.1 26.36
mScarlet-H 551 592 41 74,000 0.2 14.8 4.8 m 264.0 1.3 26.36

Sequence Comparison

FVS3D           MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWD
6VVTK           MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWD
588N2           MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWD

FVS3D           ILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLI
6VVTK           ILSPQFMYGSRAFiKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLI
588N2           ILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLI

FVS3D           YKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKT
6VVTK           YKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKT
588N2           YKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKhALRLKDGGRYLADFKT

FVS3D           TYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
6VVTK           TYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
588N2           TYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

References

  1. Bindels et al. (2016) mScarlet: a bright monomeric red fluorescent protein for cellular imaging. Nature Methods.Journal   Pubmed

  2. Mastop et al. (2017) Characterization of a spectrally diverse set of fluorescent proteins as FRET acceptors for mTurquoise2. Scientific Reports.Journal   Pubmed

  3. Chertkova et al. (2017) Robust and Bright Genetically Encoded Fluorescent Markers for Highlighting Structures and Compartments in Mammalian Cells. .Journal

  4. Wang et al. (2018) Spying on protein interactions in living cells with reconstituted scarlet light. The Analyst.Journal