compare

Comparison List

mScarlet-H

mScarlet-H is a basic (constitutively fluorescent) orange fluorescent protein published in 2016, derived from synthetic construct. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 588N2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
551 592 74,000 0.2 14.8 4.8 264.0 1.3

mScarlet-H OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
82.0 (284 cells) 2.2 ± 0.2 (33 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
574.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)
368.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)

mScarlet-H Sequence

mScarlet-H was derived from mScarlet with the following mutations: M164H

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKHALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76537
IPG: 129830966

Excerpts

Screening for a more photostable mScarlet variant yielded mScarlet-H, with a single amino acid substitution (M164H) causing a >2-fold improvement in photostability, albeit accompanied by a serious decrease in quantum yield and fluorescence lifetime.

Bindels et al. (2016)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change