compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mT-Sapphire

You are viewing an older revision of this protein, from Dec 3, 2018 18:21:57. Click here to view the current version.

mT-Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2008, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.9 kDa	-

FPbase ID: KSK4V

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
399	511	44,000	0.6	26.4	4.9

Edit States/Attributes

mT-Sapphire OSER Measurements

% Normal Cells	OSER/NE ratio	Cell Type	Reference
95.5 ± 0.6 (10000 cells)	-	HeLa	Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mT-Sapphire Sequence

BLAST

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVMVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mT-Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescent protein FRET pairs for ratiometric imaging of dual biosensors

Ai H-, Hazelwood Kl, Davidson Mw, Campbell Re

(2008). Nature Methods, 5(5) , 401-403. doi: 10.1038/nmeth.1207. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for mT-Sapphire
Search RIKEN BRC for mT-Sapphire

Change history

Something missing or incorrect? Submit a change Submit a change