compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mT-Sapphire

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Dec 3, 2018 18:21:57. Or view the full change history

mT-Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2008, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Aequorea victoria	26.9 kDa	-

FPbase ID: KSK4V

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
399	511	44,000	0.6	26.4	4.9	156.5

Edit States/Attributes

mT-Sapphire OSER Measurements

% Normal Cells	OSER/NE ratio	Cell Type	Reference
95.5 ± 0.6 (10000 cells)	-	HeLa	Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mT-Sapphire Sequence

BLAST

mT-Sapphire was derived from T-Sapphire with the following mutations: A207KA206K
amino acid numbers relative to T-SapphireavGFP. show relative to avGFP show relative to T-Sapphire

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVMVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mT-Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).