compare

Comparison List

T-Sapphire

similar: mT-Sapphire

T-Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2003, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

FPbase ID: NLY5P

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 511 44,000 0.6 26.4 4.9 156.5 2.93
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
25.0   Zapata-Hommer & Griesbeck (2003)
A caution on interpretation of photostability measurements
Add photostability info

T-Sapphire Sequence

BLAST

T-Sapphire was derived from Sapphire with the following mutations: M1_S2insV/Q69M/C70V/V163A/S175G

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVMVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for T-Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Efficiently folding and circularly permuted variants of the Sapphire mutant of GFP.

Zapata-Hommer O, Griesbeck O

(2003). BMC Biotechnology, 3(1) , 5. doi: 10.1186/1472-6750-3-5. Article   Pubmed

Additional References

  1. Combination of Novel Green Fluorescent Protein Mutant TSapphire and DsRed Variant mOrange to Set Up a Versatile in Planta FRET-FLIM Assay

    Bayle V, Nussaume L, Bhat Ra

    (2008). Plant Physiology, 148(1) , 51-60. doi: 10.1104/pp.108.117358. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change