compare

Comparison List

mT-Sapphire

similar: T-Sapphire

mT-Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2008, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: KSK4V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 511 44,000 0.6 26.4 4.9 156.5  

mT-Sapphire OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
95.5 ± 0.6 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mT-Sapphire Sequence

mT-Sapphire was derived from T-Sapphire with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to T-Sapphire

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVMVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mT-Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-Photon Excitation Spectra of Various Fluorescent Proteins within a Broad Excitation Range

    Leben R, Lindquist Rl, Hauser Ae, Niesner R, Rakhymzhan A

    (2022). International Journal of Molecular Sciences, 23(21) , 13407. doi: 10.3390/ijms232113407. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change