compare

Comparison List

mT-Sapphire

similar: T-Sapphire

mT-Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2008, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 511 44,000 0.6 26.4 4.9    

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
95.5 ± 0.6 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

mT-Sapphire Sequence

mT-Sapphire was derived from T-Sapphire with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to T-Sapphire

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVMVFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSIQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mT-Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change