compare

Comparison List

mScarlet-I

mScarlet-I is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
mScarlet-I Spectrum Fluorescent protein mScarlet-I excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 6VVTK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 593 104,000 0.54 56.16 5.4 36.0 3.1

mScarlet-I OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
76.0 (199 cells) 1.4 ± 0.2 (23 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
190.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)
225.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)

mScarlet-I Sequence

mScarlet-I was derived from mScarlet with the following mutations: T74I

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFIKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76536
IPG: 129830965

Excerpts

The single amino acid substitution T74I found in mScarlet-I results in a marked maturation acceleration in cells, but at the cost of a moderate decrease in fluorescence quantum yield (0.54) and fluorescence lifetime (3.1 ns), although both values are still higher than those of all previously engineered bright mRFPs.

Bindels et al. (2016)

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change