compare

Comparison List

mKate

mKate is a basic (constitutively fluorescent) red fluorescent protein published in 2007, derived from Entacmaea quadricolor. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.0 kDa -

FPbase ID: WRF55

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 635 45,000 0.33 14.85 6.2    
Edit States/Attributes

mKate OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
54.5 ± 4.8 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mKate Sequence

BLAST

mKate was derived from TagRFP with the following mutations: R67K/N143S/F174L/H197R

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for mKate
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Bright far-red fluorescent protein for whole-body imaging

Shcherbo D, Merzlyak Em, Chepurnykh Tv, Fradkov Af, Ermakova Gv, Solovieva Ea, Lukyanov Ka, Bogdanova Ea, Zaraisky Ag, Lukyanov S, Chudakov Dm

(2007). Nature Methods, 4(9) , 741-746. doi: 10.1038/nmeth1083. Article   Pubmed

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  2. A Crystallographic Study of Bright Far-Red Fluorescent Protein mKate Reveals pH-inducedcis-transIsomerization of the Chromophore

    Pletnev S, Shcherbo D, Chudakov Dm, Pletneva N, Merzlyak Em, Wlodawer A, Dauter Z, Pletnev V

    (2008). Journal of Biological Chemistry, 283(43) , 28980-28987. doi: 10.1074/jbc.m800599200. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change