compare

Comparison List

mEos2

mEos2 is a photoconvertible green/yellow fluorescent protein published in 2009, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.
+
mEos2 Spectrum Fluorescent protein mEos2 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: OTXRQ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 506 519 56,000 0.84 47.04 5.6   3.5
Red 573 584 46,000 0.66 30.36 6.4   4.1

Transitions

From To Switch λ
Green Red 405

mEos2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
11.0 ± 6.2 (10000 cells) - HeLa Paez-Segala et al. (2015)

Photostability

State t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
Green 14.0 24.0 (µW) Laser Point Scanning Confocal H2B Zhang et al. (2012)
Green 240.0 100.0 (µW) Laser Point Scanning Confocal H2B McKinney et al. (2009)
Green 42.0 175.0 (mW/cm2) Arc-lamp Widefield H2B McKinney et al. (2009)
Red 48.0 64.0 (µW) Laser Point Scanning Confocal H2B Zhang et al. (2012)
Red 2700.0 100.0 (µW) Laser Point Scanning Confocal H2B McKinney et al. (2009)
Red 323.0 475.0 (mW/cm2) Arc-lamp Widefield H2B McKinney et al. (2009)

mEos2 Sequence

mEos2 was derived from mEosFP with the following mutations: N11K/E70K/H74N/H121Y

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

mEos2 forms oligomers at high concentrations and forms aggregates when labeling membrane proteins

Zhang et al. (2012)

Primary Reference

Additional References

  1. Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins

    Berardozzi R, Adam V, Martins A, Bourgeois D

    (2016). Journal of the American Chemical Society, 138(2) , 558-565. doi: 10.1021/jacs.5b09923. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change