compare

Comparison List

mCitrine

similar: Citrine

mCitrine is a basic (constitutively fluorescent) yellow fluorescent protein published in 2001, derived from Aequorea victoria.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.1 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
516 529 69,000 0.72 49.68      

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
93.8 ± 2.6 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

mCitrine Sequence

mCitrine was derived from Citrine with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to Citrine

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCitrine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Reducing the Environmental Sensitivity of Yellow Fluorescent Protein

Griesbeck O, Baird Gs, Campbell Re, Zacharias Da, Tsien Ry

(2001). Journal of Biological Chemistry, 276(31) , 29188-29194. doi: 10.1074/jbc.m102815200. Article   Pubmed

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change