compare

Comparison List

mCherry1.5

mCherry1.5 is a fluorescent protein published in 2017, derived from Discosoma sp.. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

mCherry1.5 Sequence

mCherry1.5 was derived from mCherry with the following mutations: K92N/K138C/K139R/N196D
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFNWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQCRTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

The mCherry-K92N/K138C/K139R/N196D variant, with just four of the six mCherry2 mutations, permitted a relative faster E. coli growth rate than EGFP, suggesting that this variant (designated as mCherry1.5) had even lower cytotoxicity than EGFP and mCherry2... Unfortunately, both mCherry1.5 and mCherry itself showed similar patterns of protein mislocalization in these fusions, as compared to identical mEGFP fusions, indicating that the low bacterial cytotoxicity of an RFP does not necessarily correlate with more faithful fusion protein localization. Based on this result and our cumulative experience with engineering RFPs, we suggest that ameliorating the mislocalization of RFPs may ultimately require a high-throughput image-based screen of mammalian cells expressing a library of RFP variants in the context of a fusion that tends to mislocalize.

Shen et al. (2017)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change