compare

Comparison List

Katushka

a.k.a. TurboFP635

Katushka is a basic (constitutively fluorescent) red fluorescent protein published in 2007, derived from Entacmaea quadricolor.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.0 kDa -

FPbase ID: Q2ZO7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 635 65,000 0.34 22.1      
Edit States/Attributes

Katushka OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
- (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

Katushka Sequence

BLAST

Katushka was derived from TurboRFP with the following mutations: E3V/K6T/N21D/A68T/F110L/I115L/R138L/N143S/G152S/F174L/H193Y/H197R/K220R/R231S

Note: The sequence below matches the one shown in the primary reference (Shcherbo et al., 2007), but it commonly shown (e.g. at SnapGene) with an addition at the N-terminus: M1_S2insVGED

MSVLITENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGCLIYNVKINGVNFPSNGPVMQKKTLGWEASTEMLYPADSGLRGHSQMALKLVGGGYLHCSLKTTYRSKKPAKNLKMPGFYFVDRRLERIKEADKETYVEQHEMAVARYCDLPSKLGHS

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for Katushka
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Bright far-red fluorescent protein for whole-body imaging

Shcherbo D, Merzlyak Em, Chepurnykh Tv, Fradkov Af, Ermakova Gv, Solovieva Ea, Lukyanov Ka, Bogdanova Ea, Zaraisky Ag, Lukyanov S, Chudakov Dm

(2007). Nature Methods, 4(9) , 741-746. doi: 10.1038/nmeth1083. Article   Pubmed

Additional References

  1. Crystallographic study of red fluorescent protein eqFP578 and its far-red variant Katushka reveals opposite pH-induced isomerization of chromophore

    Pletneva Nv, Pletnev Vz, Shemiakina Ii, Chudakov Dm, Artemyev I, Wlodawer A, Dauter Z, Pletnev S

    (2011). Protein Science, 20(7) , 1265-1274. doi: 10.1002/pro.654. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change