compare

Comparison List

Katushka

a.k.a. TurboFP635

Katushka is a basic (constitutively fluorescent) red fluorescent protein published in 2007, derived from Entacmaea quadricolor.
+
Aggregation Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 635 65,000 0.34 22.1      

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
- (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

Katushka Sequence

Katushka was derived from TurboRFP with the following mutations: E3V/K6T/N21D/A68T/F110L/I115L/R138L/N143S/G152S/F174L/H193Y/H197R/K220R/R231S

MSVLITENMHMKLYMEGTVNDHHFKCTSEGEGKPYEGTQTMKIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTATQDTSLQNGCLIYNVKINGVNFPSNGPVMQKKTLGWEASTEMLYPADSGLRGHSQMALKLVGGGYLHCSLKTTYRSKKPAKNLKMPGFYFVDRRLERIKEADKETYVEQHEMAVARYCDLPSKLGHS

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for Katushka
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change