compare

Comparison List

IrisFP

similar: mIrisFP

IrisFP is a multi-photochromic orange fluorescent protein published in 2008, derived from Lobophyllia hemprichii.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Lobophyllia hemprichii 25.7 kDa -

FPbase ID: PA6OT

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 488 516 52,200 0.43 22.45 5.7    
Orange 551 580 35,400 0.47 16.64      
Green (off)              
Orange (off)              
Edit States/Attributes

Transitions

From To Switch λ
Green (off) Green 405
Green Orange 405
Orange (off) Orange 440
Green Green (off) 488
Orange Orange (off) 561
Edit state transitions

Photostability

No photostability measurements available ... add one!

IrisFP Sequence

BLAST

IrisFP was derived from EosFP with the following mutations: F173S/F191L

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITMALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for IrisFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Structural characterization of IrisFP, an optical highlighter undergoing multiple photo-induced transformations

Adam V, Lelimousin M, Boehme S, Desfonds G, Nienhaus K, Field Mj, Wiedenmann J, Mcsweeney S, Nienhaus Gu, Bourgeois D

(2008). Proceedings of the National Academy of Sciences, 105(47) , 18343-18348. doi: 10.1073/pnas.0805949105. Article   Pubmed

Additional References

  1. Serial Femtosecond Crystallography and Ultrafast Absorption Spectroscopy of the Photoswitchable Fluorescent Protein IrisFP

    Colletier J-P, Sliwa M, Gallat F-X, Sugahara M, Guillon V, Schirò G, Coquelle N, Woodhouse J, Roux L, Gotthard G, Royant A, Uriarte Lm, Ruckebusch C, Joti Y, Byrdin M, Mizohata E, Nango E, Tanaka T, Tono K, Yabashi M, Adam V, Cammarata M, Schlichting I, Bourgeois D, Weik M

    (2016). The Journal of Physical Chemistry Letters, 7(5) , 882-887. doi: 10.1021/acs.jpclett.5b02789. Article   Pubmed

  2. Rational design of enhanced photoresistance in a photoswitchable fluorescent protein

    Duan C, Byrdin M, El Khatib M, Henry X, Adam V, Bourgeois D

    (2015). Methods and Applications in Fluorescence, 3(1) , 014004. doi: 10.1088/2050-6120/3/1/014004. Article   Pubmed

  3. Structural Evidence for a Two-Regime Photobleaching Mechanism in a Reversibly Switchable Fluorescent Protein

    Duan C, Adam V, Byrdin M, Ridard J, Kieffer-Jaquinod S, Morlot C, Arcizet D, Demachy I, Bourgeois D

    (2013). Journal of the American Chemical Society, 135(42) , 15841-15850. doi: 10.1021/ja406860e. Article   Pubmed

  4. From EosFP to mIrisFP: structure-based development of advanced photoactivatable marker proteins of the GFP-family

    Wiedenmann J, Gayda S, Adam V, Oswald F, Nienhaus K, Bourgeois D, Nienhaus Gu

    (2011). Journal of Biophotonics, 4(6) , 377-390. doi: 10.1002/jbio.201000122. Article   Pubmed

  5. The Nature of Transient Dark States in a Photoactivatable Fluorescent Protein

    Roy A, Field Mj, Adam V, Bourgeois D

    (2011). Journal of the American Chemical Society, 133(46) , 18586-18589. doi: 10.1021/ja2085355. Article   Pubmed

  6. Data storage based on photochromic and photoconvertible fluorescent proteins

    Adam V, Mizuno H, Grichine A, Hotta J-, Yamagata Y, Moeyaert B, Nienhaus Gu, Miyawaki A, Bourgeois D, Hofkens J

    (2010). Journal of Biotechnology, 149(4) , 289-298. doi: 10.1016/j.jbiotec.2010.04.001. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change