compare

Comparison List

mIrisFP

similar: IrisFP

mIrisFP is a multi-photochromic green fluorescent protein published in 2010, derived from Lobophyllia hemprichii. It is reported to be a very rapidly-maturing monomer with moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.7 kDa -

FPbase ID: KDHFJ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 486 516 47,000 0.54 25.38 5.4 14.0  
Red 546 578 33,000 0.59 19.47 7.6    
Green (Off)              
Red (Off)              
Edit States/Attributes

Transitions

From To Switch λ
Green (Off) Green 386
Green Red 405
Red (Off) Red 446
Green Green (Off) 486
Red Red (Off) 546
Edit state transitions

Photostability

No photostability measurements available ... add one!

mIrisFP Sequence

BLAST

mIrisFP was derived from mEosFP with the following mutations: A69V/K145I/F173S/Y189A

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFVEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGTNFPANGPVMQKKTLKWEPSTEIMYVRDGVLTGDIHMALLLEGNAHYRCDSRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mIrisFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A photoactivatable marker protein for pulse-chase imaging with superresolution

Fuchs J, Böhme S, Oswald F, Hedde Pn, Krause M, Wiedenmann J, Nienhaus Gu

(2010). Nature Methods, 7(8) , 627-630. doi: 10.1038/nmeth.1477. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change