compare

Comparison List

Citrine

similar: mCitrine

Citrine is a basic (constitutively fluorescent) yellow fluorescent protein published in 2001, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 27.0 kDa -

FPbase ID: VR7EN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
516 529 77,000 0.76 58.52 5.7   3.6

Citrine OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
36.2 ± 3.9 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
49.0   Barstow et al. (2008)

Citrine Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Citrine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Reducing the Environmental Sensitivity of Yellow Fluorescent Protein

Griesbeck O, Baird Gs, Campbell Re, Zacharias Da, Tsien Ry

(2001). Journal of Biological Chemistry, 276(31) , 29188-29194. doi: 10.1074/jbc.m102815200. Article   Pubmed

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  2. Alteration of citrine structure by hydrostatic pressure explains the accompanying spectral shift

    Barstow B, Ando N, Kim Cu, Gruner Sm

    (2008). Proceedings of the National Academy of Sciences, 105(36) , 13362-13366. doi: 10.1073/pnas.0802252105. Article   Pubmed

  3. An improved cyan fluorescent protein variant useful for FRET

    Rizzo Ma, Springer Gh, Granada B, Piston Dw

    (2004). Nature Biotechnology, 22(4) , 445-449. doi: 10.1038/nbt945. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change