compare

Comparison List

td8oxStayGold

a.k.a. td8oxSG

td8oxStayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tandem dimer Cytaeis uchidae 54.2 kDa -

FPbase ID: VKDX5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 506 157,000 0.93 146.01      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

td8oxStayGold Sequence

BLAST

td8oxStayGold was derived from td5oxStayGold with the following mutations: P173s_P173wdelinsY/A173yR/S173zT/A173aK/V173bL/V173b_G173cinsE

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAYQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHLYSRTKLEGHGTGSTGSGSSGTASSEDNNIDMVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAYQNTIIKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHIIQSETLEAHL

Excerpts

We found that PT can be used as another adaptor for fusion at the StayGold C terminus. By replacing c4 with PT in td5oxStayGold, we generated td8oxStayGold... Both td8oxStayGold and td8ox2StayGold exhibited excellent dispersibility.

Ando et al. (2023)

Primary Reference

StayGold variants for molecular fusion and membrane-targeting applications

Ando R, Shimozono S, Ago H, Takagi M, Sugiyama M, Kurokawa H, Hirano M, Niino Y, Ueno G, Ishidate F, Fujiwara T, Okada Y, Yamamoto M, Miyawaki A

(2023). Nature Methods, , . doi: 10.1038/s41592-023-02085-6. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change