compare

Comparison List

Slow-FT

Slow-FT is a timer fluorescent protein published in 2009, derived from Discosoma sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: COE5V

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Slow-FT Sequence

Slow-FT was derived from mCherry with the following mutations: M18V/E30V/K70R/L83W/A175V
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHVEGSVNGHEFEIVGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSRAYVKHPADIPDYWKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDVEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

Fast-FT, Medium-FT and Slow-FT exhibit distinctive fast, medium and slow blue-to-red chromophore maturation rates that depend on the temperature. At 37 °C, the maxima of the blue fluorescence is observed at 9.8 h for slow-FT. The half-maxima of the red fluorescence is reached at 28 h.

Subach et al. (2009)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change