compare

Comparison List

mOrange2

mOrange2 is a basic (constitutively fluorescent) orange fluorescent protein published in 2008, derived from Discosoma sp.. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: 5GR1V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
549 565 58,000 0.6 34.8 6.5 270.0 2.7
Edit States/Attributes

mOrange2 OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
91.8 ± 1.4 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
228.0   Dean et al. (2015)
A caution on interpretation of photostability measurements
Add photostability info

mOrange2 Sequence

BLAST

mOrange2 was derived from mOrange with the following mutations: Q64H/F99Y/E160K/G196D
amino acid numbers relative to DsRed. show relative to mOrange

MVSKGEENNMAIIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGFQTAKLKVTKGGPLPFAWDILSPHFTYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNYEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGKIKMRLKLKDGGHYTSEVKTTYKAKKPVQLPGAYIVDIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
GenBank: ABC66096
IPG: 5194148

Excerpts

No excerpts have been added for mOrange2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving the photostability of bright monomeric orange and red fluorescent proteins

Shaner Nc, Lin Mz, Mckeown Mr, Steinbach Pa, Hazelwood Kl, Davidson Mw, Tsien Ry

(2008). Nature Methods, 5(6) , 545-551. doi: 10.1038/nmeth.1209. Article   Pubmed

Additional References

  1. Two-Photon Excitation Spectra of Various Fluorescent Proteins within a Broad Excitation Range

    Leben R, Lindquist Rl, Hauser Ae, Niesner R, Rakhymzhan A

    (2022). International Journal of Molecular Sciences, 23(21) , 13407. doi: 10.3390/ijms232113407. Article

  2. High-Speed Multiparameter Photophysical Analyses of Fluorophore Libraries

    Dean Km, Davis Lm, Lubbeck Jl, Manna P, Friis P, Palmer Ae, Jimenez R

    (2015). Analytical Chemistry, 87(10) , 5026-5030. doi: 10.1021/acs.analchem.5b00607. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change