compare

Comparison List

mCitrine

similar: Citrine

mCitrine is a basic (constitutively fluorescent) yellow fluorescent protein published in 2002, derived from Aequorea victoria.
+
mCitrine Spectrum Fluorescent protein mCitrine excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 27.1 kDa -

FPbase ID: 3Q37R

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
516 529 94,000 0.74 69.56      

mCitrine OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
93.8 ± 2.6 (10000 cells) - HeLa Cranfill et al. (2016)
93.8 ± 2.6 (10000 cells) - HeLa Hoi et al. (2013)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
32.7 20.0 (mW/mm2) LED Widefield HEK239A 24.0 Lee et al. (2020)
27.3 20.0 (mW/mm2) LED Widefield Saccharomyces cerevisiae 24.0 Lee et al. (2020)

mCitrine Sequence

mCitrine was derived from Citrine with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to Citrine

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLMCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for mCitrine
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Partitioning of Lipid-Modified Monomeric GFPs into Membrane Microdomains of Live Cells

Zacharias Da

(2002). Science, 296(5569) , 913-916. doi: 10.1126/science.1068539. Article   Pubmed

Additional References

  1. Versatile phenotype-activated cell sorting

    Lee J, Liu Z, Suzuki Ph, Ahrens Jf, Lai S, Lu X, Guan S, St-Pierre F

    (2020). Science Advances, 6(43) , eabb7438. doi: 10.1126/sciadv.abb7438. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  3. Reducing the Environmental Sensitivity of Yellow Fluorescent Protein

    Griesbeck O, Baird Gs, Campbell Re, Zacharias Da, Tsien Ry

    (2001). Journal of Biological Chemistry, 276(31) , 29188-29194. doi: 10.1074/jbc.m102815200. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change