compare

Comparison List

YPet

YPet is a basic (constitutively fluorescent) yellow fluorescent protein published in 2005, derived from Aequorea victoria. It has moderate acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
517 530 104,000 0.77 80.08 5.63    

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
62.5 ± 5.2 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

YPet Sequence

YPet was derived from EYFP with the following mutations: F46L/I47L/F64L/L68V/M153T/V163A/S175G/S208F/V224L/L231E/D234N
amino acid numbers relative to avGFP. show relative to EYFP

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLLCTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLEFLTAAGITEGMNELYK

Excerpts

Nguyen and Daugherty (2005) reported the development of an improved FRET pair, YPet & CyPet, which had a sevenfold enhancement of the FRET signal. However, we discovered that most of the signal enhancement was due to enhanced dimerization of YPet to CyPet within the tethered construct, and was substantially reduced when we incorporated the monomerizing mutation previously developed to prevent the weak dimerization of GFP (Zacharias et al. 2002).

Ohashi et al. (2007)

Primary Reference

Evolutionary optimization of fluorescent proteins for intracellular FRET

Nguyen Aw, Daugherty Ps

(2005). Nature Biotechnology, 23(3) , 355-360. doi: 10.1038/nbt1066. Article   Pubmed

Additional References

  1. Advances in fluorescent protein technology

    Shaner Nc, Patterson Gh, Davidson Mw

    (2007). Journal of Cell Science, 120(24) , 4247-4260. doi: 10.1242/jcs.005801. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change