compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

YFP3

This protein has unmoderated changes. Click here to view the last moderated version of this protein from May 10, 2019 20:17:02. Or view the full change history

YFP3 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2005, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	27.0 kDa	-

FPbase ID: UPG56

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
514	527	99,000	0.76	75.24	5.79

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

YFP3 Sequence

BLAST

YFP3 was derived from EYFP-F46L with the following mutations: V2del/I48L/Q81R/S209F/V225L/L232E/D235NV1adel/I47L/Q80R/S208F/V224L/L231E/D234N
amino acid numbers relative to EYFP-F46LavGFP. show relative to avGFP show relative to EYFP-F46L

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLLCTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLEFLTAAGITEGMNELYK

Excerpts

YFP3 possessed six mutations that resulted in an RRC almost fivefold greater than that of the parental pair. YFP3 also conferred a roughly threefold improvement in FRET relative to the fast-maturing Venus YFP.

Nguyen & Daugherty (2005)

Primary Reference

Evolutionary optimization of fluorescent proteins for intracellular FRET

Nguyen Aw, Daugherty Ps

(2005). Nature Biotechnology, 23(3) , 355-360. doi: 10.1038/nbt1066. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for YFP3
Search RIKEN BRC for YFP3

Change history

Something missing or incorrect? Submit a change Submit a change