compare

Comparison List

smURFP

a.k.a. small Ultra Red Fluorescent Protein

similar: TDsmURFP

smURFP is a basic (constitutively fluorescent) near ir fluorescent protein published in 2016, derived from Trichodesmium erythraeum IMS101. It requires the cofactor biliverdin for fluorescence.
+
Aggregation Organism Molecular Weight Cofactor
Dimer Trichodesmium erythraeum IMS101 15.0 kDa Biliverdin

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
642 670 180,000 0.18 32.4      

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
570.0 Arc-lamp Widefield 37.0

smURFP Sequence

smURFP was derived from R3-2+PCB with the following mutations: M1_K2insA/G4S/K9N/S15T/E18K/R33H/F36L/G45S/E48D/Y59F/R61H/D73G/G82S/G96A/K118N/Q129K

MAKTSEQRVNIATLLTENKKKIVDKASQDLWRRHPDLIAPGGIAFSQRDRALCLRDYGWFLHLITFCLLAGDKGPIESIGLISIREMYNSLGVPVPAMMESIRCLKEASLSLLDEEDANETAPYFDYIIKAMS
GenBank: KX449134

Excerpts

In our approach, we first evolved TeAPCα mutants to autocatalytically attach PCB (without a lyase) and fluoresce. Second, since PCB is not present in mammals, we evolved derivatives that bind BV, a molecule ubiquitous in eukaryotes and produced at the rate of 300–500 mg per d in humans.

Rodriguez et al. (2016)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change