compare

Comparison List

TDsmURFP

a.k.a. Tandem Dimer smURFP, Tandem Dimer small Ultra Red Fluorescent Protein

similar: smURFP

TDsmURFP is a basic (constitutively fluorescent) near ir fluorescent protein published in 2016, derived from Trichodesmium erythraeum IMS101. It requires the cofactor biliverdin for fluorescence.
+
Aggregation Organism Molecular Weight Cofactor
Tandem dimer Trichodesmium erythraeum IMS101 32.0 kDa Biliverdin

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
642 670 170,000 0.18 30.6      

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
190.0 Arc-lamp Widefield Rodriguez et al. (2016)

TDsmURFP Sequence

TDsmURFP was derived from smURFP with the following mutations: M1_A2insAKTSEQRVNIATLLTENKKKIVDKASQDLWRRHPDLIAPGGIAFSQRDRALCLRDYGWFLHLITFCLLAGDKGPIESIGLISIREMYNSLGVPVPAMMESIRCLKEASLSLLDEEDANETAPYFDYIIKAMSGHGTGSTGSGSSGTASSEDNNMAM

MAKTSEQRVNIATLLTENKKKIVDKASQDLWRRHPDLIAPGGIAFSQRDRALCLRDYGWFLHLITFCLLAGDKGPIESIGLISIREMYNSLGVPVPAMMESIRCLKEASLSLLDEEDANETAPYFDYIIKAMSGHGTGSTGSGSSGTASSEDNNMAMAKTSEQRVNIATLLTENKKKIVDKASQDLWRRHPDLIAPGGIAFSQRDRALCLRDYGWFLHLITFCLLAGDKGPIESIGLISIREMYNSLGVPVPAMMESIRCLKEASLSLLDEEDANETAPYFDYIIKAMS
GenBank: KX449135

Excerpts

No excerpts have been added for TDsmURFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change