compare

Comparison List

R3-2+PCB

R3-2+PCB is an intermediate phycobiliprotein created in the evolution of the far-red smURFP proteins. Unlike its ancestral TeAPCα, it autocatalytically attaches PCB (without a lyase).

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Trichodesmium erythraeum IMS101 15.0 kDa Phycocyanobilin

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
620 648 74,000 0.13 9.62      

Photostability

no photostability measurements available ... add one!

R3-2+PCB Sequence

R3-2+PCB was derived from TeAPCα with the following mutations: N42I/Y65F/G66C/V83I/V98M

MKTGEQRVKIATLLSENEKKIVDKASQDLWRRRPDFIAPGGIAFGQRERALCLRDYGWYLRLITFCLLAGDKDPIESIGLIGIREMYNSLGVPVPGMMESIRCLKEASLSLLDEEDAKETAPYFDYIIQAMS

Excerpts

No excerpts have been added for R3-2+PCB
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change