compare

Comparison List

TeAPCα

TeAPCα is a light-harvesting phycobiliprotein from cyanobacteria (Trichodesmium erythraeum) that was used as the precursor for the far-red smURFP fluorescent proteins. Native APC is a highly fluorescent hexamer (three α + β dimers) that requires an auxiliary protein known as a lyase to incorporate phycocyanobilin (PCB).

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Trichodesmium erythraeum IMS101 14.9 kDa Phycocyanobilin

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

TeAPCα Sequence

MKTGEQRVKIATLLSENEKKIVDKASQDLWRRRPDFIAPGGNAFGQRERALCLRDYGWYLRLITYGLLAGDKDPIESIGLIGVREMYNSLGVPVPGMVESIRCLKEASLSLLDEEDAKETAPYFDYIIQAMS

Excerpts

We chose TeAPCα (15 kD) [as a precursor for smURFP] because it lacked 29 amino acids common to other APCαs. Expression of TeAPCα with heme oxygenase-1 (HO-1) and phycocyanobilin–ferredoxin oxidoreductase (PcyA) for PCB production showed no fluorescence.

Rodriguez et al. (2016)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change