compare

Comparison List

TeAPCα

a.k.a. Alpha-allophycocyanin

TeAPCα is a light-harvesting phycobiliprotein from cyanobacteria (Trichodesmium erythraeum) that was used as the precursor for the far-red smURFP fluorescent proteins. Native APC is a highly fluorescent hexamer (three α + β dimers) that requires an auxiliary protein known as a lyase to incorporate phycocyanobilin (PCB).

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Trichodesmium erythraeum IMS101 14.9 kDa Phycocyanobilin

FPbase ID: VW66D

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

TeAPCα Sequence

BLAST
MKTGEQRVKIATLLSENEKKIVDKASQDLWRRRPDFIAPGGNAFGQRERALCLRDYGWYLRLITYGLLAGDKDPIESIGLIGVREMYNSLGVPVPGMVESIRCLKEASLSLLDEEDAKETAPYFDYIIQAMS
GenBank: CP000393.1
UniProtKB: Q10VH4
IPG: ABG53750.1

Excerpts

We chose TeAPCα (15 kD) [as a precursor for smURFP] because it lacked 29 amino acids common to other APCαs. Expression of TeAPCα with heme oxygenase-1 (HO-1) and phycocyanobilin–ferredoxin oxidoreductase (PcyA) for PCB production showed no fluorescence.

Rodriguez et al. (2016)

Primary Reference

A far-red fluorescent protein evolved from a cyanobacterial phycobiliprotein

Rodriguez Ea, Tran Gn, Gross La, Crisp Jl, Shu X, Lin Jy, Tsien Ry

(2016). Nature Methods, 13(9) , 763-769. doi: 10.1038/nmeth.3935. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change