compare

Comparison List

TeAPCα

TeAPCα is a light-harvesting phycobiliprotein from cyanobacteria (Trichodesmium erythraeum) that was used as the precursor for the far-red smURFP fluorescent proteins. Native APC is a highly fluorescent hexamer (three α + β dimers) that requires an auxiliary protein known as a lyase to incorporate phycocyanobilin (PCB).

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Trichodesmium erythraeum IMS101 14.9 kDa Phycocyanobilin

FPbase ID: VW66D

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

TeAPCα Sequence

MKTGEQRVKIATLLSENEKKIVDKASQDLWRRRPDFIAPGGNAFGQRERALCLRDYGWYLRLITYGLLAGDKDPIESIGLIGVREMYNSLGVPVPGMVESIRCLKEASLSLLDEEDAKETAPYFDYIIQAMS

Excerpts

We chose TeAPCα (15 kD) [as a precursor for smURFP] because it lacked 29 amino acids common to other APCαs. Expression of TeAPCα with heme oxygenase-1 (HO-1) and phycocyanobilin–ferredoxin oxidoreductase (PcyA) for PCB production showed no fluorescence.

Rodriguez et al. (2016)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change