compare

Comparison List

rsFusionRed3

rsFusionRed3 is a photoswitchable red fluorescent protein published in 2018, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with low acid sensitivity.
+
rsFusionRed3 Spectrum Fluorescent protein rsFusionRed3 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

FPbase ID: 13ANW

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 580 607 38,000 0.08 3.04 4.7 25.0  

Transitions

From To Switch λ
Off On 405
On On 592

Photostability

No photostability measurements available ... add one!

rsFusionRed3 Sequence

rsFusionRed3 was derived from FusionRed with the following mutations: R67K/S143H/C172A
amino acid numbers relative to eqFP578. show relative to FusionRed

MVSELIKENMPMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPANGPVMQKKTLGWEAHTETMYPADGGLEGACDMALKLVGGGHLIANLETTYRSKKPATNLKMPGVYNVDHRLERIKEADDETYVEQHEVAVARYSTGGAGDGGK
GenBank: AXF35914

Excerpts

No excerpts have been added for rsFusionRed3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change