compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

rsFusionRed3

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Sep 16, 2019 16:06:04. Or view the full change history

rsFusionRed3 is a photoswitchable red fluorescent protein published in 2018, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with low acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Entacmaea quadricolor	25.6 kDa	-

FPbase ID: 13ANW

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Off
On	580	607	38,000	0.08	3.04	4.7	25.0

Edit States/Attributes

Transitions

From	To	Switch λ
Off	On	405
On	Off	592

Edit state transitions

Photostability

No photostability measurements available ... add one!

rsFusionRed3 Sequence

BLAST

rsFusionRed3 was derived from FusionRed with the following mutations: R68K/S144H/C173AR67K/S143H/C172A
amino acid numbers relative to FusionRedeqFP578. show relative to eqFP578 show relative to FusionRed

MVSELIKENMPMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPANGPVMQKKTLGWEAHTETMYPADGGLEGACDMALKLVGGGHLIANLETTYRSKKPATNLKMPGVYNVDHRLERIKEADDETYVEQHEVAVARYSTGGAGDGGK

GenBank: AXF35914

Excerpts

No excerpts have been added for rsFusionRed3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fast reversibly photoswitching red fluorescent proteins for live-cell RESOLFT nanoscopy

Pennacchietti F, Serebrovskaya Eo, Faro Ar, Shemyakina Ii, Bozhanova Ng, Kotlobay Aa, Gurskaya Ng, Bodén A, Dreier J, Chudakov Dm, Lukyanov Ka, Verkhusha Vv, Mishin As, Testa I

(2018). Nature Methods, 15(8) , 601-604. doi: 10.1038/s41592-018-0052-9. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for rsFusionRed3
Search RIKEN BRC for rsFusionRed3

Change history

Something missing or incorrect? Submit a change Submit a change