compare

Comparison List

rsFastLime

rsFastLime is a photoswitchable green fluorescent protein published in 2007, derived from Echinophyllia sp. SC22.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Echinophyllia sp. SC22 25.4 kDa -

FPbase ID: XJO9Z

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 496 518 39,094 0.77 30.1     2.9

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

No photostability measurements available ... add one!

rsFastLime Sequence

rsFastLime was derived from Dronpa with the following mutations: V157G

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDGNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK
GenBank: ABV80244
IPG: 13822637

Excerpts

In the fluorescent equilibrium state, we find that the chromophore adopts exclusively the cis isomeric form. Surprisingly, the chromophore environment of Dronpa is almost identical to that of KikG, a fluorescent protein that does not exhibit photoswitching. Furthermore, we find structural similarities to asFP595 that point to a cis–trans isomerization of the chromophore as a key event in photochromic switching. Based on this assumption and the obtained structural information we generated rsFastLime (Dronpa-V157G) and Dronpa-M159T [aka Dronpa-2], two variants that exhibit strongly accelerated switching kinetics. Our findings support the view of a photoinduced cis–trans isomerization of the chromophore in Dronpa.

Stiel et al. (2007)

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change