compare

Comparison List

Dronpa-2

a.k.a. Dronpa-M159T

Dronpa-2 is a photoswitchable green fluorescent protein published in 2007, derived from Echinophyllia sp. SC22.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.5 kDa -

FPbase ID: 52ADP

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 490 515 61,732 0.33 20.37      
Off              
Edit States/Attributes

Transitions

From To Switch λ
Off On 405
On Off 490
Edit state transitions

Photostability

No photostability measurements available ... add one!

Dronpa-2 Sequence

BLAST

Dronpa-2 was derived from Dronpa with the following mutations: M159T

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNTALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Excerpts

No excerpts have been added for Dronpa-2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Highlighted Generation of Fluorescence Signals Using Simultaneous Two-Color Irradiation on Dronpa Mutants

Ando R, Flors C, Mizuno H, Hofkens J, Miyawaki A

(2007). Biophysical Journal, 92(12) , L97-L99. doi: 10.1529/biophysj.107.105882. Article   Pubmed

Additional References

  1. 1.8 Å bright-state structure of the reversibly switchable fluorescent protein Dronpa guides the generation of fast switching variants

    Stiel Ac, Trowitzsch S, Weber G, Andresen M, Eggeling C, Hell Sw, Jakobs S, Wahl Mc

    (2007). Biochemical Journal, 402(1) , 35-42. doi: 10.1042/bj20061401. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change