compare

Comparison List

Dronpa-2

a.k.a. Dronpa-M159T

Dronpa-2 is a photoswitchable green fluorescent protein published in 2007, derived from Echinophyllia sp. SC22.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.5 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 490 515 61,732 0.33 20.37      

Transitions

From To Switch λ
Off On 405
On Off 490

Photostability

no photostability measurements available ... add one!

Dronpa-2 Sequence

Dronpa-2 was derived from Dronpa with the following mutations: M159T

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNTALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Excerpts

No excerpts have been added for Dronpa-2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change