compare

Comparison List

KikG

KikG is a fluorescent protein published in 2005, derived from Favia favus. It is reported to be a tetramer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Favia favus 25.9 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

KikG Sequence

MSVITSEMKMELRMEGAVNGHKFVITGKGSGQPFEGIQNMDLTVIEGGPLPFAFDILTTVFDYGNRVFVKYPEEIVDYFKQSFPEGYSWERSMSYEDGGICLATNNITMKKDGSNCFVYEIRFDGVNFPANGPVMQRKTVKWEPSTEKMYVRDGVLKGDVNMALLLQGGGHYRCDFRTTYKAKKVVQLPDYHFVDHRIEITSHDKDYNKVKLYEHAKAHSGLPRLAK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for KikG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change