compare

Comparison List

PDM1-4

PDM1-4 is a fluorescent protein published in 2012, derived from Echinophyllia sp. SC22. It is reported to be a tetramer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Echinophyllia sp. SC22 25.5 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

PDM1-4 Sequence

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTENLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for PDM1-4
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Structural basis for the influence of a single mutation K145N on the oligomerization and photoswitching rate of Dronpa

Nguyen Bich N, Moeyaert B, Van Hecke K, Dedecker P, Mizuno H, Hofkens J, Van Meervelt L

(2012). Acta Crystallographica Section D Biological Crystallography, 68(12) , 1653-1659. doi: 10.1107/s0907444912039686. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change