compare

Comparison List

PAmKate

PAmKate is a photoactivatable red fluorescent protein published in 2011, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.3 kDa -

FPbase ID: DTAXR

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 586 628 25,000 0.18 4.5 5.6 19.0  
Off              

Transitions

From To Switch λ
Off On 405

Photostability

No photostability measurements available ... add one!

PAmKate Sequence

PAmKate was derived from mKate with the following mutations: F80W/S143N/S158G/*230LextN
amino acid numbers relative to eqFP578. show relative to mKate

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRGDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLN

Excerpts

To convert mKate into a PAFP, we mutated amino acid residues at positions 69, 84, 148, 165, 167, 181, and 203 (numbering follows the alignment with green fluorescent protein (GFP) , which were crucial for photoactivation of the chromophore in PAmCherry1.

Gunewardene et al. (2011)

Primary Reference

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change