compare

Comparison List

Padron

Padron is a multistate green fluorescent protein published in 2008, derived from Pectiniidae.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Pectiniidae 25.5 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 503 522 43,000 0.64 27.52      
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

no photostability measurements available ... add one!

Padron Sequence

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTMAFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMHYEDGGSCNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWERSTEKLYVRDGVLKSDGNYALSLEGGGHYRCDFKTTYKAKKVVQLPDYHSVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRNAK

Excerpts

No excerpts have been added for Padron
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change