compare

Comparison List

NijiFP

NijiFP is a multi-photochromic yellow fluorescent protein published in 2011, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

FPbase ID: 87UEF

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Orange (off)              
Green (off)              
Orange 526 569 42,000 0.65 27.3 7.3   4.2
Green 469 507 41,100 0.64 26.3 7.0   3.4

Transitions

From To Switch λ
Green Orange 405
Green (off) Green 405
Orange (off) Orange 440
Green Green (off) 488
Orange Orange (off) 561

Photostability

No photostability measurements available ... add one!

NijiFP Sequence

NijiFP was derived from Dendra2 with the following mutations: F173S
amino acid numbers relative to dendFP. show relative to Dendra2

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDSKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVW

Excerpts

No excerpts have been added for NijiFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change