compare

Comparison List

NijiFP

NijiFP is a multi-photochromic yellow fluorescent protein published in 2011, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Dendronephthya sp. 26.1 kDa -

FPbase ID: 87UEF

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green (off)              
Orange (off)              
Green 469 507 41,100 0.64 26.3 7.0   3.4
Orange 526 569 42,000 0.65 27.3 7.3   4.2
Edit States/Attributes

Transitions

From To Switch λ
Green (off) Green 405
Green Orange 405
Orange (off) Orange 440
Green Green (off) 488
Orange Orange (off) 561
Edit state transitions

Photostability

No photostability measurements available ... add one!

NijiFP Sequence

BLAST

NijiFP was derived from Dendra2 with the following mutations: F173S
amino acid numbers relative to dendFP. show relative to Dendra2

MNTPGINLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTANLTVKEGAPLPFSYDILTTAVHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTFEDKGICTIRSDISLEGDCFFQNVRFKGTNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDSKTTYKAKKVVQLPDAHFVDHRIEILGNDSDYNKVKLYEHAVARYSPLPSQVW

Excerpts

No excerpts have been added for NijiFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Design of Photoconvertible and Biphotochromic Fluorescent Proteins for Advanced Microscopy Applications

Adam V, Moeyaert B, David Cc, Mizuno H, Lelimousin M, Dedecker P, Ando R, Miyawaki A, Michiels J, Engelborghs Y, Hofkens J

(2011). Chemistry & Biology, 18(10) , 1241-1251. doi: 10.1016/j.chembiol.2011.08.007. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change