compare

Comparison List

(n1)StayGold

a.k.a. (n1)SG

(n1)StayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2022, derived from Cytaeis uchidae.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Cytaeis uchidae 25.6 kDa -

FPbase ID: 4Y1D1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
496 505          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

(n1)StayGold Sequence

BLAST

(n1)StayGold was derived from StayGold with the following mutations: A2V/T4_P5insGEELFTGVV

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNEVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

Excerpts

StayGold’s head and tail are relatively short, which makes this FP sensitive to C- and N-terminal fusions. We borrowed termini from other proven FPs and found that nine amino acids from the N-terminal region of EGFP (n1 or n2) and ten amino acids at the C-terminus of dfGFP (c4) could be fused to StayGold to improve its targeting function to some subcellular components.

Hirano et al. (2022)

Primary Reference

A highly photostable and bright green fluorescent protein

Hirano M, Ando R, Shimozono S, Sugiyama M, Takeda N, Kurokawa H, Deguchi R, Endo K, Haga K, Takai-Todaka R, Inaura S, Matsumura Y, Hama H, Okada Y, Fujiwara T, Morimoto T, Katayama K, Miyawaki A

(2022). Nature Biotechnology, , . doi: 10.1038/s41587-022-01278-2. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change