compare

Comparison List

mPlum

mPlum is a basic (constitutively fluorescent) red fluorescent protein published in 2004, derived from Discosoma sp.. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.6 kDa -

FPbase ID: XU2WO

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
590 649 41,000 0.1 4.1 4.5 100.0  
Edit States/Attributes

mPlum OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
91.5 ± 2.4 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
53.0   Wang et al. (2004)
A caution on interpretation of photostability measurements
Add photostability info

mPlum Sequence

BLAST

mPlum was derived from mRFP1.2 with the following mutations: V16E/R17H/K45R/F65I/L124V/I161M/K166R
amino acid numbers relative to DsRed. show relative to mRFP1.2

MVSKGEEVIKEFMRFKEHMEGSVNGHEFEIEGEGEGRPYEGTQTARLKVTKGGPLPFAWDILSPQIMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKVRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEMKMRLRLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA
GenBank: AAV65487
UniProtKB: Q5S3G7
IPG: 3876945

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for mPlum
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Evolution of new nonantibody proteins via iterative somatic hypermutation

Wang L, Jackson Wc, Steinbach Pa, Tsien Ry

(2004). Proceedings of the National Academy of Sciences, 101(48) , 16745-16749. doi: 10.1073/pnas.0407752101. Article   Pubmed

Additional References

  1. Far-Red Emission of mPlum Fluorescent Protein Results from Excited-State Interconversion between Chromophore Hydrogen-Bonding States

    Yoon E, Konold Pe, Lee J, Joo T, Jimenez R

    (2016). The Journal of Physical Chemistry Letters, 7(12) , 2170-2174. doi: 10.1021/acs.jpclett.6b00823. Article   Pubmed

  2. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change