compare

Comparison List

mRFP1.2

mRFP1.2 is a basic (constitutively fluorescent) red fluorescent protein, derived from Discosoma sp..
+
Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
590 612          

Photostability

no photostability measurements available ... add one!

mRFP1.2 Sequence

mRFP1.2 was derived from mRFP1.1 with the following mutations: M1_D6delinsMVSKGEE

MVSKGEEVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA

Excerpts

No excerpts have been added for mRFP1.2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Evolving proteins in mammalian cells using somatic hypermutation

    Wang L, Tsien Ry

    (2006). Nature Protocols, 1(3) , 1346-1350. doi: 10.1038/nprot.2006.243. Article   Pubmed

  2. Evolution of new nonantibody proteins via iterative somatic hypermutation

    Wang L, Jackson Wc, Steinbach Pa, Tsien Ry

    (2004). Proceedings of the National Academy of Sciences, 101(48) , 16745-16749. doi: 10.1073/pnas.0407752101. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change