compare

Comparison List

mMaple3

mMaple3 is a photoconvertible green fluorescent protein published in 2014, derived from Clavularia sp..
+
Aggregation Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.2 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 491 506 15,760 0.37 5.83      
Red 568 583 23,970 0.52 12.46      

Transitions

From To Switch λ
Green Red 405

Photostability

no photostability measurements available ... add one!

mMaple3 Sequence

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPRKIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPKAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK

Excerpts

No excerpts have been added for mMaple3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Characterization and development of photoactivatable fluorescent proteins for single-molecule-based superresolution imaging

Wang S, Moffitt Jr, Dempsey Gt, Xie Xs, Zhuang X

(2014). Proceedings of the National Academy of Sciences, 111(23) , 8452-8457. doi: 10.1073/pnas.1406593111. Article   Pubmed

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change