compare

Comparison List

mMaple3

mMaple3 is a photoconvertible green fluorescent protein published in 2014, derived from Clavularia sp..
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.2 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 491 506 15,760 0.37 5.83      
Red 568 583 23,970 0.52 12.46      

Transitions

From To Switch λ
Green Red 405

Photostability

no photostability measurements available ... add one!

mMaple3 Sequence

mMaple3 was derived from mMaple2 with the following mutations: E115R/D116K/D229K
amino acid numbers relative to cFP484. show relative to mMaple2

MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPRKIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPKAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK

Excerpts

To further reduce the residual dimerization tendency of mMaple2, we screened a series of mutations to residues that are predicted to be solvent-exposed near residues 111 and 198. We focused on charged residues and switched them to the opposite charge. One of the derivatives, with mutations E82R, D83K, and D197K, in addition to I111N and Y198A, exhibited undetectable dimerization tendency when fused to ClpP. This derivative, which we termed mMaple3, again had a similar photon budget to that of mMaple and even a lower on–off ratio compared with mMaple. Its signaling efficiency was only moderately reduced from those of mMaple or mMaple2.

Wang et al. (2014)

Primary Reference

Characterization and development of photoactivatable fluorescent proteins for single-molecule-based superresolution imaging

Wang S, Moffitt Jr, Dempsey Gt, Xie Xs, Zhuang X

(2014). Proceedings of the National Academy of Sciences, 111(23) , 8452-8457. doi: 10.1073/pnas.1406593111. Article   Pubmed

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change