Change History for mMaple3
-
2018-10-06 12:46, user: talley
- added protein mMaple3 seq: MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPRKIPDYFKQSFPEGYSWERSMTYEDGGICNATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPKAHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK
-
2018-10-06 13:02, user: talley
- added protein mMaple3 default_state_id: 546
- added protein mMaple3 switch_type: o
- added State mMaple3 (Red)
- added State mMaple3 (Green)
-
2018-10-06 13:03, user: talley
- added state transition Transition: mMaple3 Green -> Red
-
2018-10-06 13:10, user: talley
- added protein mMaple3 agg: m
- changed protein mMaple3 switch_type: o->pc
-
2018-10-06 13:36, user: talley
- added protein mMaple3 references: Kaberniuk et al. (2018)
-
2018-10-06 13:37, user: talley
- added State mMaple3 (Red) brightness: 12.46
- added State mMaple3 (Red) ext_coeff: 23970
- added State mMaple3 (Red) qy: 0.52
- added State mMaple3 (Green) brightness: 5.83
- added State mMaple3 (Green) ext_coeff: 15760
- added State mMaple3 (Green) qy: 0.37
-
2018-10-21 15:43, user: talley
- changed protein mMaple3 default_state_id: 546->545
- added protein mMaple3 parent_organism_id: 86521
-
2018-12-16 02:47, user: talley
- added protein mMaple3 references: Wang et al. (2014)
- added excerpt Wang et al. (2014): To further reduce the residual...
-
2018-12-16 02:48, user: talley
Back to current mMaple3 version