FPbase: The Fluorescent Protein Database

Javascript is disabled! Many pages and features of FPbase will not work properly

2018-03-02 22:04, user: talley
- added protein mMaple references: Durisic et al. (2014)
2018-10-06 13:57, user: talley
- changed protein mMaple aliases: None->[]
- changed protein mMaple pdb: None->[]
- added protein mMaple seq: MVSKGEETIMSVIKPDMKIKLRMEGNVNGHAFVIEGEGSGKPFEGIQTIDLEVKEGAPLPFAYDILTTAFHYGNRVFTKYPEDIPDYFKQSFPEGYSWERSMTYEDGGICIATNDITMEEDSFINKIHFKGTNFPPNGPVMQKRTVGWEVSTEKMYVRDGVLKGDVKMKLLLKGGSHYRCDFRTTYKVKQKAVKLPDYHFVDHRIEILSHDKDYNKVKLYEHAVARNSTDSMDELYK
2018-10-21 15:42, user: talley
- added protein mMaple parent_organism_id: 86521
2018-12-16 02:06, user: talley
- added lineage mMaple
2018-12-16 02:06, user: talley
- changed protein mMaple seq_validated: False->True
2018-12-16 02:07, user: talley
- added protein mMaple genbank: ASA47684
- added protein mMaple ipg_id: 152367004
2018-12-16 02:13, user: talley
- added excerpt McEvoy et al. (2012): Single pcFP counting in indivi...
2018-12-16 02:17, user: talley
- added excerpt McEvoy et al. (2012): When the brightness of a large...
2018-12-16 02:38, user: talley
- added protein mMaple references: Wang et al. (2014)
- added excerpt Wang et al. (2014): ... we compared the relative s...
2018-12-16 02:45, user: talley
- changed lineage mMaple rght: 27->29
- added excerpt Wang et al. (2014): We first took inspiration from...