compare

Comparison List

MiCy

a.k.a. Midori-ishi Cyan

similar: mMiCy

MiCy is a basic (constitutively fluorescent) cyan fluorescent protein published in 2004, derived from Acropora sp. #30. It has high acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Dimer Acropora sp. #30 26.2 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
472 495 27,250 0.9 24.52 6.6   3.4

OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
41.7 ± 10.7 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

no photostability measurements available ... add one!

MiCy Sequence

MVSYSKQGIAQEMRTKYRMEGSVNGHEFTIEGVGTGNPYEGKQMSELVIIKSKGKPLPFSFDILSTAFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGGVATASWSIRLEGNCFIHNSIYHGVNFPADGPVMKKQTIGWDKSFEKMSVAKEVLRGDVTQFLLLEGGGYQRCRFHSTYKTEKPVAMPPSHVVEHQIVRTDLGQTAKGFKVKLEEHAEAHVNPLKVK
GenBank: BAD24723
UniProtKB: Q6I7B1
IPG: 3504960

Excerpts

Due to the high value and pH-resistance of the QE, MiCy would probably be a more efficient and reliable donor for FRET than ECFP. In addition, fluorescence lifetime measurement revealed that MiCy fluorescence displayed as a single exponential decay with a time constant of 3.4 ns.

KARASAWA et al. (2004)

Since all of the non-bioluminescent Anthozoan GFP-like proteins characterized so far form obligate tetramers (Labas et al 2002), the dimer formation of MiCy may indicate structural divergence of the protein family.

KARASAWA et al. (2004)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change