compare

Comparison List

ECFP

a.k.a. W1B

similar: mECFP

ECFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 1996, derived from Aequorea victoria. It has low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 477 32,500 0.4 13.0 4.7   3.0

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
85.0 Kremers et al. (2006)

ECFP Sequence

ECFP was derived from W7 with the following mutations: M1_S2insV/F64L/S65T/K212N/H231L

Note: The ECFP line is sometimes incorrectly reported as having the mutation N149I (instead of N146I) with respect to wild-type avGFP (e.g. see Supp Table 2 of Shaner et al 2005 ... since corrected in the online media). The correct mutation is N146I, which first appeared in the W7 mutant (Heim & Tsien 1996), from which most CFPs are evolved.

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTWGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for ECFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  2. An improved cyan fluorescent protein variant useful for FRET

    Rizzo Ma, Springer Gh, Granada B, Piston Dw

    (2004). Nature Biotechnology, 22(4) , 445-449. doi: 10.1038/nbt945. Article   Pubmed

  3. THE GREEN FLUORESCENT PROTEIN

    Tsien Ry

    (1998). Annual Review of Biochemistry, 67(1) , 509-544. doi: 10.1146/annurev.biochem.67.1.509. Article   Pubmed

  4. Wavelength mutations and posttranslational autoxidation of green fluorescent protein.

    Heim R, Prasher Dc, Tsien Ry

    (1994). Proceedings of the National Academy of Sciences, 91(26) , 12501-12504. doi: 10.1073/pnas.91.26.12501. Article

External Resources

Something missing or incorrect? Submit a change Submit a change