compare

Comparison List

mEosFP-F173S

mEosFP-F173S is a multi-photochromic orange fluorescent protein published in 2011, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: 81ENW

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 550 581 25,000 0.41 10.25 6.2   3.7
Red (off)              
Green (off)              
Green 486 514 53,200 0.43 22.88 5.8   3.3

Transitions

From To Switch λ
Green Red 405
Green (off) Green 405
Red (off) Red 440
Green Green (off) 488
Red Red (off) 561

Photostability

No photostability measurements available ... add one!

mEosFP-F173S Sequence

mEosFP-F173S was derived from mEosFP with the following mutations: A69V/F173S/F191L

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFVEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mEosFP-F173S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change