compare

Comparison List

mEosFP-F173S

mEosFP-F173S is a multi-photochromic orange fluorescent protein published in 2011, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

FPbase ID: 81ENW

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 486 514 53,200 0.43 22.88 5.8   3.3
Green (off)              
Red (off)              
Red 550 581 25,000 0.41 10.25 6.2   3.7
Edit States/Attributes

Transitions

From To Switch λ
Green Red 405
Green (off) Green 405
Red (off) Red 440
Green Green (off) 488
Red Red (off) 561
Edit state transitions

Photostability

No photostability measurements available ... add one!

mEosFP-F173S Sequence

BLAST

mEosFP-F173S was derived from mEosFP with the following mutations: A69V/F173S/F191L

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFVEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mEosFP-F173S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Design of Photoconvertible and Biphotochromic Fluorescent Proteins for Advanced Microscopy Applications

Adam V, Moeyaert B, David Cc, Mizuno H, Lelimousin M, Dedecker P, Ando R, Miyawaki A, Michiels J, Engelborghs Y, Hofkens J

(2011). Chemistry & Biology, 18(10) , 1241-1251. doi: 10.1016/j.chembiol.2011.08.007. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change